General Information

  • ID:  hor005276
  • Uniprot ID:  P69102
  • Protein name:  Melanostatin
  • Gene name:  NA
  • Organism:  Rana temporaria (European common frog)
  • Family:  NPY family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Rana (subgenus), Rana (genus), Ranidae (family), Ranoidea (superfamily), Neobatrachia (suborder), Anura (order), Batrachia (superorder), Amphibia (class), Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007218 neuropeptide signaling pathway
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  YPSKPDNPGEDAPAEDMAKYYSALRHYINLITRQRY
  • Length:  36(1-36)
  • Propeptide:  YPSKPDNPGEDAPAEDMAKYYSALRHYINLITRQRY
  • Signal peptide:  NA
  • Modification:  T36 Tyrosine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  NPY is implicated in the control of feeding and in secretion of gonadotrophin-release hormone. NPY may play a physiological role in the regulation of pituitary melanotrophs.
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-P69102-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    AF-P69102-F1.pdbhor005276_AF2.pdbhor005276_ESM.pdb

Physical Information

Mass: 486917 Formula: C189H284N52O58S
Absent amino acids: CFVW Common amino acids: Y
pI: 7.51 Basic residues: 6
Polar residues: 11 Hydrophobic residues: 8
Hydrophobicity: -117.78 Boman Index: -9898
Half-Life: 2.8 hour Half-Life Yeast: 10 min
Half-Life E.Coli: 2 min Aliphatic Index 54.44
Instability Index: 6583.33 Extinction Coefficient cystines: 7450
Absorbance 280nm: 212.86

Literature

  • PubMed ID:  1539111
  • Title:  The primary structure and tissue distribution of an amphibian neuropeptide Y.